PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc032995.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 135aa    MW: 14987.2 Da    PI: 6.5022
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc032995.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1271.5e-0877121146
                     FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekk 46 
                              +fY +Y   vGF+vr s+ kk  r+++++ + +vCs+eg+++ ++ 
  Itr_sc032995.1_g00001.1  77 DFYLKYDALVGFDVRHSTVKKD-RDRKVVLKYLVCSREGYKSMSSG 121
                              6****************99998.666699999********998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031017.1E-677122IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MVQVSTVSPA SSFIAIVVYS LLFPAPVDHC DGVMFDEGEG GRVEISLGST RYWWPACEDG  60
SKPVTGQCFE TLDDGMDFYL KYDALVGFDV RHSTVKKDRD RKVVLKYLVC SREGYKSMSS  120
GRQISKVGVV TMVVR